PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G011100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TALE
Protein Properties Length: 374aa    MW: 41549.6 Da    PI: 6.5955
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G011100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-093013352155
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         k +yps++++  LA+++gL+++q+ +WF N+R ++
  Potri.011G011100.1 301 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 335
                         569*****************************885 PP

2ELK37.74.3e-13255276122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK qLlr YsgyLgsLkqEF+
  Potri.011G011100.1 255 ELKGQLLRRYSGYLGSLKQEFM 276
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.5E-19119163IPR005540KNOX1
PfamPF037906.0E-21121159IPR005540KNOX1
SMARTSM012565.1E-26168219IPR005541KNOX2
PfamPF037911.3E-20171218IPR005541KNOX2
PROSITE profilePS5121310.912255275IPR005539ELK domain
SMARTSM011888.6E-8255276IPR005539ELK domain
PfamPF037891.8E-10255276IPR005539ELK domain
PROSITE profilePS5007112.989275338IPR001356Homeobox domain
SuperFamilySSF466891.33E-19277352IPR009057Homeodomain-like
SMARTSM003897.4E-13277342IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-28280340IPR009057Homeodomain-like
CDDcd000861.80E-12287339No hitNo description
PfamPF059206.8E-17295334IPR008422Homeobox KN domain
PROSITE patternPS000270313336IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MEGGGGDGGS STTSCMMAFG DNSNGLCPMM MMTPLMSSSS SAHHQHPHHH HRANEGDSSI  60
SNTLFLPLPP TNNQGHNRIH SNASGSSSMI IDDHNRNHNN NTVTATGCYF MDNNDGSSSS  120
VKAKIMAHPH YHRLLAAYAN CQKVGAPPEV VARLEEACAS AASIAPANTG CIGEDPALDQ  180
FMEAYCEMLT KYEQELSKPL KEAMLFLQRV ECQFKALTLS SPISGCGDGN DRNVSSEEEV  240
DVNNNFIDPQ AEDQELKGQL LRRYSGYLGS LKQEFMKKRK KGKLPKEARQ QLLDWWSRHY  300
KWPYPSESQK LALAESTGLD QKQINNWFIN QRKRHWKPSE DMQFVVMDAG HPHYYMDNVL  360
GNPFPMDISP TLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1270279LKQEFMKKRK
2276280KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.32820.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6849370.0AY684937.1 Populus balsamifera subsp. trichocarpa x Populus deltoides homeobox transcription factor KN2 (Kn2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002564.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-157HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLQ5UL960.0Q5UL96_9R
STRINGVIT_10s0116g00190.t011e-179(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-139KNOX/ELK homeobox transcription factor